CBR1 anticorps (Middle Region)

N° du produit ABIN630569

L’anticorps Lapin Polyclonal anti-CBR1 a été validé pour WB. Il convient pour détecter CBR1 dans des échantillons de Humain.

Aperçu rapide pour CBR1 anticorps (Middle Region) (ABIN630569)

Antigène: CBR1 (Carbonyl Reductase 1 (CBR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CBR1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CBR1 anticorps

Épitope: Middle Region

Specificité: Carbonyl Reductase 1 antibody was raised against the middle region of CBR1

Purification: Affinity purified

Immunogène: Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carbonyl Reductase 1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CBR1

Antigène: CBR1 (Carbonyl Reductase 1 (CBR1))

Autre désignation: Carbonyl Reductase 1

Sujet: Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.

Poids moléculaire: 30 kDa (MW of target protein)